Lineage for d1x6aa2 (1x6a A:42-75)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035813Protein Lim domain kinase 2 [144183] (1 species)
  7. 3035814Species Human (Homo sapiens) [TaxId:9606] [144184] (1 PDB entry)
    Uniprot P53671 62-95! Uniprot P53671 96-129
  8. 3035816Domain d1x6aa2: 1x6a A:42-75 [121738]
    Other proteins in same PDB: d1x6aa3, d1x6aa4
    complexed with zn

Details for d1x6aa2

PDB Entry: 1x6a (more details)

PDB Description: solution structures of the second lim domain of human lim-kinase 2 (limk2)
PDB Compounds: (A:) LIM domain kinase 2

SCOPe Domain Sequences for d1x6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
facmsckviiedgdayalvqhatlycgkchnevv

SCOPe Domain Coordinates for d1x6aa2:

Click to download the PDB-style file with coordinates for d1x6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1x6aa2: