![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
![]() | Protein PDZ and LIM domain protein 1 Elfin [144171] (1 species) C-terminal LIM domain protein 1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144172] (1 PDB entry) Uniprot O00151 249-279! Uniprot O00151 280-314 |
![]() | Domain d1x62a2: 1x62 A:8-42 [121730] Other proteins in same PDB: d1x62a3, d1x62a4 complexed with zn |
PDB Entry: 1x62 (more details)
SCOPe Domain Sequences for d1x62a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} signaqklpmcdkcgtgivgvfvklrdrhrhpecy
Timeline for d1x62a2: