![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries) Uniprot Q9Y2H6 192-315 |
![]() | Domain d1x5xa1: 1x5x A:8-103 [121724] Other proteins in same PDB: d1x5xa2, d1x5xa3 |
PDB Entry: 1x5x (more details)
SCOPe Domain Sequences for d1x5xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} psmpaspvltkagitwlslqwskpsgtpsdegisyilemeeetsgygfkpkydgedlayt vknlrrstkykfkviaynsegksnpsevvefttcpd
Timeline for d1x5xa1: