Lineage for d1x5xa1 (1x5x A:8-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761872Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 2761873Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
    Uniprot Q9Y2H6 192-315
  8. 2761879Domain d1x5xa1: 1x5x A:8-103 [121724]
    Other proteins in same PDB: d1x5xa2, d1x5xa3

Details for d1x5xa1

PDB Entry: 1x5x (more details)

PDB Description: solution structure of the fibronectin type-iii domain of human fibronectin type iii domain containing protein 3
PDB Compounds: (A:) Fibronectin type-III domain containing protein 3a

SCOPe Domain Sequences for d1x5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
psmpaspvltkagitwlslqwskpsgtpsdegisyilemeeetsgygfkpkydgedlayt
vknlrrstkykfkviaynsegksnpsevvefttcpd

SCOPe Domain Coordinates for d1x5xa1:

Click to download the PDB-style file with coordinates for d1x5xa1.
(The format of our PDB-style files is described here.)

Timeline for d1x5xa1: