Lineage for d1x5ga1 (1x5g A:8-110)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2036046Protein Neogenin [141053] (1 species)
  7. 2036047Species Human (Homo sapiens) [TaxId:9606] [141054] (6 PDB entries)
    Uniprot Q92859 429-535! Uniprot Q92859 529-631! Uniprot Q92859 623-741! Uniprot Q92859 718-830! Uniprot Q92859 853-952! Uniprot Q92859 942-1054
  8. 2036051Domain d1x5ga1: 1x5g A:8-110 [121708]
    Other proteins in same PDB: d1x5ga2, d1x5ga3

Details for d1x5ga1

PDB Entry: 1x5g (more details)

PDB Description: the solution structure of the second fibronectin type iii domain of human neogenin
PDB Compounds: (A:) Neogenin

SCOPe Domain Sequences for d1x5ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}
rvetqpevqlpgpapnlrayaasptsitvtwetpvsgngeiqnyklyymekgtdkeqdvd
vsshsytinglkkyteysfrvvaynkhgpgvstpdvavrtlsd

SCOPe Domain Coordinates for d1x5ga1:

Click to download the PDB-style file with coordinates for d1x5ga1.
(The format of our PDB-style files is described here.)

Timeline for d1x5ga1: