Lineage for d1x57a1 (1x57 A:8-85)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268481Family a.35.1.12: EDF1-like [140529] (1 protein)
    part of Pfam PF01381
  6. 1268482Protein Endothelial differentiation-related factor 1, EDF1 [140530] (1 species)
  7. 1268483Species Human (Homo sapiens) [TaxId:9606] [140531] (1 PDB entry)
    Uniprot O60869 71-148
  8. 1268484Domain d1x57a1: 1x57 A:8-85 [121704]

Details for d1x57a1

PDB Entry: 1x57 (more details)

PDB Description: solution structures of the hth domain of human edf-1 protein
PDB Compounds: (A:) Endothelial differentiation-related factor 1

SCOPe Domain Sequences for d1x57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]}
drvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgkieraigl
klrgkdigkpiekgprak

SCOPe Domain Coordinates for d1x57a1:

Click to download the PDB-style file with coordinates for d1x57a1.
(The format of our PDB-style files is described here.)

Timeline for d1x57a1: