SCOP 1.73: Domain d1x57a1: 1x57 A:8-85

Lineage for d1x57a1 (1x57 A:8-85)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.12: EDF1-like [140529] (1 protein)
   part of Pfam PF01381

6. Protein Endothelial differentiation-related factor 1, EDF1 [140530] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140531] (1 PDB entry)

8. Domain d1x57a1: 1x57 A:8-85 [121704]

Details for d1x57a1

PDB Entry: 1x57

PDB Description: solution structures of the hth domain of human edf-1 protein

PDB Compounds: (A:) Endothelial differentiation-related factor 1

SCOP Domain Sequences for d1x57a1:

Sequence; same for both SEQRES and ATOM records:

>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]}
drvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgkieraigl
klrgkdigkpiekgprak

Timeline for d1x57a1:

• d1x57a1 is new in SCOP 1.73
  
• d1x57a1 appears in SCOP 1.75
  
• d1x57a1 appears in the current release, SCOPe 2.08