Lineage for d1x40a1 (1x40 A:8-85)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272211Protein Centaurin-delta 1 (Arap2) [140624] (1 species)
  7. 1272212Species Human (Homo sapiens) [TaxId:9606] [140625] (1 PDB entry)
    Uniprot Q8WZ64 1-78
  8. 1272213Domain d1x40a1: 1x40 A:8-85 [121675]

Details for d1x40a1

PDB Entry: 1x40 (more details)

PDB Description: solution structure of the sam domain of human arap2
PDB Compounds: (A:) arap2

SCOPe Domain Sequences for d1x40a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human (Homo sapiens) [TaxId: 9606]}
mssvsevnvdikdflmsinleqyllhfhesgfttvkdcaaindsllqkigisptghrrri
lkqlqiilskmqdipiya

SCOPe Domain Coordinates for d1x40a1:

Click to download the PDB-style file with coordinates for d1x40a1.
(The format of our PDB-style files is described here.)

Timeline for d1x40a1: