Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein Centaurin-delta 1 (Arap2) [140624] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140625] (1 PDB entry) Uniprot Q8WZ64 1-78 |
Domain d1x40a1: 1x40 A:8-85 [121675] |
PDB Entry: 1x40 (more details)
SCOPe Domain Sequences for d1x40a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human (Homo sapiens) [TaxId: 9606]} mssvsevnvdikdflmsinleqyllhfhesgfttvkdcaaindsllqkigisptghrrri lkqlqiilskmqdipiya
Timeline for d1x40a1: