Lineage for d1x2ta_ (1x2t A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442853Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1442854Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)
  8. 1442856Domain d1x2ta_: 1x2t A: [121648]
    Other proteins in same PDB: d1x2tb_, d1x2td_
    automated match to d1bj3a_
    complexed with 1pe, ca

Details for d1x2ta_

PDB Entry: 1x2t (more details), 1.72 Å

PDB Description: crystal structure of habu ix-bp at ph 6.5
PDB Compounds: (A:) Coagulation factor IX/X-binding protein A chain

SCOPe Domain Sequences for d1x2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ta_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea

SCOPe Domain Coordinates for d1x2ta_:

Click to download the PDB-style file with coordinates for d1x2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1x2ta_: