Lineage for d1x2ta1 (1x2t A:1-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738161Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 738162Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)
  8. 738164Domain d1x2ta1: 1x2t A:1-129 [121648]
    Other proteins in same PDB: d1x2tb1, d1x2td1
    automatically matched to d1bj3a_
    complexed with 1pe, ca

Details for d1x2ta1

PDB Entry: 1x2t (more details), 1.72 Å

PDB Description: crystal structure of habu ix-bp at ph 6.5
PDB Compounds: (A:) Coagulation factor IX/X-binding protein A chain

SCOP Domain Sequences for d1x2ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ta1 d.169.1.1 (A:1-129) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea

SCOP Domain Coordinates for d1x2ta1:

Click to download the PDB-style file with coordinates for d1x2ta1.
(The format of our PDB-style files is described here.)

Timeline for d1x2ta1: