Lineage for d1x2la1 (1x2l A:9-95)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768258Family a.35.1.7: CUT domain [116891] (4 proteins)
    Pfam PF02376
  6. 768271Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)
  7. 768272Species Human (Homo sapiens) [TaxId:9606] [116893] (3 PDB entries)
    Uniprot O14529 825-912; 966-1063
  8. 768274Domain d1x2la1: 1x2l A:9-95 [121644]
    1st CUT domain

Details for d1x2la1

PDB Entry: 1x2l (more details)

PDB Description: solution structure of the cut domain of human homeobox protein cux-2 (cut-like 2)
PDB Compounds: (A:) Homeobox protein Cux-2

SCOP Domain Sequences for d1x2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2la1 a.35.1.7 (A:9-95) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]}
gpgaeeeqldtaeiafqvkeqllkhnigqrvfghyvlglsqgsvseilarpkpwrkltvk
gkepfikmkqflsdeqnvlalrtiqvr

SCOP Domain Coordinates for d1x2la1:

Click to download the PDB-style file with coordinates for d1x2la1.
(The format of our PDB-style files is described here.)

Timeline for d1x2la1: