PDB entry 1x2l

View 1x2l on RCSB PDB site
Description: Solution structure of the CUT domain of human homeobox protein Cux-2 (Cut-like 2)
Class: transcription
Keywords: CUT domain, human homeobox protein Cux-2, Cut-like 2, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Homeobox protein Cux-2
  Species: HOMO SAPIENS
  Gene: CUTL2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14529 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOP 1.75: d1x2la1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x2lA (A:)
  gssgssgagpgaeeeqldtaeiafqvkeqllkhnigqrvfghyvlglsqgsvseilarpk
  pwrkltvkgkepfikmkqflsdeqnvlalrtiqvrsgpssg