Lineage for d1wyvb_ (1wyv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132177Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 protein domains)
    Pfam PF02347
  6. 2132190Protein Glycine dehydrogenase subunit 2 (P-protein) [142681] (1 species)
  7. 2132191Species Thermus thermophilus [TaxId:274] [142682] (3 PDB entries)
    Uniprot Q5SKW7 2-472
  8. 2132198Domain d1wyvb_: 1wyv B: [121461]
    Other proteins in same PDB: d1wyva_, d1wyvc_, d1wyve_, d1wyvg_
    automated match to d1wytb1
    complexed with plp

Details for d1wyvb_

PDB Entry: 1wyv (more details), 2.4 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in inhibitor-bound form
PDB Compounds: (B:) glycine dehydrogenase subunit 2 (P-protein)

SCOPe Domain Sequences for d1wyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyvb_ c.67.1.7 (B:) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]}
sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg

SCOPe Domain Coordinates for d1wyvb_:

Click to download the PDB-style file with coordinates for d1wyvb_.
(The format of our PDB-style files is described here.)

Timeline for d1wyvb_: