PDB entry 1wyv

View 1wyv on RCSB PDB site
Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in inhibitor-bound form
Class: oxidoreductase
Keywords: ALPHA(2)BETA(2) TETRAMER, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2005-02-17, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSA
    Database cross-references and differences (RAF-indexed):
    • GB BAD70348 (0-End)
    Domains in SCOPe 2.07: d1wyva_
  • Chain 'B':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSB
    Database cross-references and differences (RAF-indexed):
    • GB BAD70349 (Start-473)
    Domains in SCOPe 2.07: d1wyvb_
  • Chain 'C':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSA
    Database cross-references and differences (RAF-indexed):
    • GB BAD70348 (0-End)
    Domains in SCOPe 2.07: d1wyvc_
  • Chain 'D':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSB
    Database cross-references and differences (RAF-indexed):
    • GB BAD70349 (Start-473)
    Domains in SCOPe 2.07: d1wyvd_
  • Chain 'E':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSA
    Database cross-references and differences (RAF-indexed):
    • GB BAD70348 (0-End)
    Domains in SCOPe 2.07: d1wyve_
  • Chain 'F':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSB
    Database cross-references and differences (RAF-indexed):
    • GB BAD70349 (Start-473)
    Domains in SCOPe 2.07: d1wyvf_
  • Chain 'G':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSA
    Database cross-references and differences (RAF-indexed):
    • GB BAD70348 (0-End)
    Domains in SCOPe 2.07: d1wyvg_
  • Chain 'H':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GCSB
    Database cross-references and differences (RAF-indexed):
    • GB BAD70349 (Start-473)
    Domains in SCOPe 2.07: d1wyvh_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wyvA (A:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvA (A:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wyvB (B:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvB (B:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wyvC (C:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvC (C:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wyvD (D:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvD (D:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wyvE (E:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvE (E:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wyvF (F:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvF (F:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wyvG (G:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvG (G:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wyvH (H:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyvH (H:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg