Lineage for d1wyha1 (1wyh A:35-66)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035782Protein Four and a half LIM domains 3, FHL3 [144167] (1 species)
    Skeletal muscle lim-protein 2
  7. 3035783Species Human (Homo sapiens) [TaxId:9606] [144168] (2 PDB entries)
    Uniprot Q13643 127-159! Uniprot Q13643 152-186! Uniprot Q13643 187-218! Uniprot Q13643 98-126
  8. 3035786Domain d1wyha1: 1wyh A:35-66 [121444]
    Other proteins in same PDB: d1wyha3, d1wyha4
    complexed with zn

Details for d1wyha1

PDB Entry: 1wyh (more details)

PDB Description: solution structure of the lim domain from human skeletal muscle lim- protein 2
PDB Compounds: (A:) Skeletal muscle LIM-protein 2

SCOPe Domain Sequences for d1wyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]}
lcsgceqplgsrsfvpdkgahycvpcyenkfa

SCOPe Domain Coordinates for d1wyha1:

Click to download the PDB-style file with coordinates for d1wyha1.
(The format of our PDB-style files is described here.)

Timeline for d1wyha1: