SCOP 1.73: Domain d1wxxd2: 1wxx D:65-382

Lineage for d1wxxd2 (1wxx D:65-382)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins)
   C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam 05958)

6. Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries)

8. Domain d1wxxd2: 1wxx D:65-382 [121425]
   Other proteins in same PDB: d1wxxa1, d1wxxb1, d1wxxc1, d1wxxd1
   automatically matched to 1WXW A:65-382
   complexed with k, po4

Details for d1wxxd2

PDB Entry: 1wxx, 1.8 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8

PDB Compounds: (D:) hypothetical protein TTHA1280

SCOP Domain Sequences for d1wxxd2:

Sequence; same for both SEQRES and ATOM records:

>d1wxxd2 c.66.1.51 (D:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl

Timeline for d1wxxd2:

• d1wxxd2 is new in SCOP 1.73
  
• d1wxxd2 appears in SCOP 1.75
  
• d1wxxd2 appears in the current release, SCOPe 2.08