| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
| Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins) C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam 05958) |
| Protein Hypothetical protein TTHA1280, middle and C-terminal domains [142638] (1 species) |
| Species Thermus thermophilus [TaxId:274] [142639] (3 PDB entries) |
| Domain d1wxxb2: 1wxx B:65-382 [121421] Other proteins in same PDB: d1wxxa1, d1wxxb1, d1wxxc1, d1wxxd1 automatically matched to 1WXW A:65-382 complexed with k, po4 |
PDB Entry: 1wxx (more details), 1.8 Å
SCOP Domain Sequences for d1wxxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxxb2 c.66.1.51 (B:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}
aedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvqatah
awegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrvrylv
dlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaeal
rraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayray
kevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpv
llnhpethylkfavfqvl
Timeline for d1wxxb2: