Lineage for d1wwse1 (1wws E:1-148)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 765239Family a.22.1.4: Bacterial histone-fold protein [101318] (2 proteins)
    duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer
  6. 765243Protein Hypothetical protein TTHA1479 [140402] (1 species)
  7. 765244Species Thermus thermophilus [TaxId:274] [140403] (2 PDB entries)
    Uniprot Q5SI95 1-148
  8. 765250Domain d1wwse1: 1wws E:1-148 [121374]
    automatically matched to 1WWI A:1-148
    complexed with ca

Details for d1wwse1

PDB Entry: 1wws (more details), 1.9 Å

PDB Description: Crystal structure of ttk003001566 from Thermus Thermophilus HB8
PDB Compounds: (E:) hypothetical protein TTHA1479

SCOP Domain Sequences for d1wwse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwse1 a.22.1.4 (E:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]}
mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl
piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar
vlkeldpalknpqtehheraervfnlll

SCOP Domain Coordinates for d1wwse1:

Click to download the PDB-style file with coordinates for d1wwse1.
(The format of our PDB-style files is described here.)

Timeline for d1wwse1: