Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.4: Bacterial histone-fold protein [101318] (2 proteins) duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer |
Protein Hypothetical protein TTHA1479 [140402] (1 species) |
Species Thermus thermophilus [TaxId:274] [140403] (2 PDB entries) Uniprot Q5SI95 1-148 |
Domain d1wwsa1: 1wws A:1-148 [121370] automatically matched to 1WWI A:1-148 complexed with ca |
PDB Entry: 1wws (more details), 1.9 Å
SCOP Domain Sequences for d1wwsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwsa1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar vlkeldpalknpqtehheraervfnlll
Timeline for d1wwsa1: