Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein automated matches [190110] (5 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:883] [186834] (5 PDB entries) |
Domain d1wuls_: 1wul S: [121296] Other proteins in same PDB: d1wull_ automated match to d1h2as_ complexed with f3s, mg, mpd, mrd, nfr, sf4 |
PDB Entry: 1wul (more details), 1.5 Å
SCOPe Domain Sequences for d1wuls_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuls_ e.19.1.1 (S:) automated matches {Desulfovibrio vulgaris [TaxId: 883]} lmgprrpsvvylhnaectgcsesvlrafepyidtlildtlsldyhetimaaagdaaeaal eqavnsphgfiavveggiptaangiygkvanhtmldicsrilpkaqaviaygtcatfggv qaakpnptgakgvndalkhlgvkainiagcppnpynlvgtivyylknkaapeldslnrpt mffgqtvheqcprlphfdagefapsfeseearkgwclyelgckgpvtmnncpkikfnqtn wpvdaghpcigcsepdfwdamtpfyqn
Timeline for d1wuls_: