![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
![]() | Protein automated matches [190110] (7 species) not a true protein |
![]() | Species Desulfovibrio vulgaris [TaxId:883] [186834] (7 PDB entries) |
![]() | Domain d1wuks_: 1wuk S: [121294] Other proteins in same PDB: d1wukl_ automated match to d1h2as_ complexed with f3s, mg, mrd, nfo, sf4 |
PDB Entry: 1wuk (more details), 1.1 Å
SCOPe Domain Sequences for d1wuks_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuks_ e.19.1.1 (S:) automated matches {Desulfovibrio vulgaris [TaxId: 883]} lmgprrpsvvylhnaectgcsesvlrafepyidtlildtlsldyhetimaaagdaaeaal eqavnsphgfiavveggiptaangiygkvanhtmldicsrilpkaqaviaygtcatfggv qaakpnptgakgvndalkhlgvkainiagcppnpynlvgtivyylknkaapeldslnrpt mffgqtvheqcprlphfdagefapsfeseearkgwclyelgckgpvtmnncpkikfnqtn wpvdaghpcigcsepdfwdamtpfyqn
Timeline for d1wuks_: