![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (2 families) ![]() |
![]() | Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein) |
![]() | Protein Nickel-iron hydrogenase, small subunit [56772] (5 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [56774] (16 PDB entries) |
![]() | Domain d1wuks1: 1wuk S:1-267 [121294] Other proteins in same PDB: d1wukl1 automatically matched to d1h2as_ complexed with f3s, mg, mrd, nfo, sf4 |
PDB Entry: 1wuk (more details), 1.1 Å
SCOP Domain Sequences for d1wuks1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuks1 e.19.1.1 (S:1-267) Nickel-iron hydrogenase, small subunit {Desulfovibrio vulgaris [TaxId: 881]} lmgprrpsvvylhnaectgcsesvlrafepyidtlildtlsldyhetimaaagdaaeaal eqavnsphgfiavveggiptaangiygkvanhtmldicsrilpkaqaviaygtcatfggv qaakpnptgakgvndalkhlgvkainiagcppnpynlvgtivyylknkaapeldslnrpt mffgqtvheqcprlphfdagefapsfeseearkgwclyelgckgpvtmnncpkikfnqtn wpvdaghpcigcsepdfwdamtpfyqn
Timeline for d1wuks1: