Lineage for d1wu9a1 (1wu9 A:191-249)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286588Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 1286589Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 1286590Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 1286591Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 1286592Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 1286593Domain d1wu9a1: 1wu9 A:191-249 [121279]

Details for d1wu9a1

PDB Entry: 1wu9 (more details), 1.54 Å

PDB Description: crystal structure of the c-terminal domain of the end-binding protein 1 (eb1)
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1wu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu9a1 a.245.1.1 (A:191-249) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

SCOPe Domain Coordinates for d1wu9a1:

Click to download the PDB-style file with coordinates for d1wu9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wu9a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wu9b_