SCOPe 2.08: Domain d1wu9a1: 1wu9 A:191-249

Lineage for d1wu9a1 (1wu9 A:191-249)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d1wu9a1: 1wu9 A:191-249 [121279]

Details for d1wu9a1

PDB Entry: 1wu9, 1.54 Å

PDB Description: crystal structure of the c-terminal domain of the end-binding protein 1 (eb1)

PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1wu9a1:

Sequence; same for both SEQRES and ATOM records:

>d1wu9a1 a.245.1.1 (A:191-249) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

Timeline for d1wu9a1:

• d1wu9a1 first appeared in SCOP 1.73
  
• d1wu9a1 appears in SCOPe 2.07