Lineage for d1wsud1 (1wsu D:512-574)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906863Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 906864Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. 906865Species Moorella thermoacetica [TaxId:1525] [74685] (5 PDB entries)
  8. 906884Domain d1wsud1: 1wsu D:512-574 [121251]
    automatically matched to d1lvaa3
    protein/RNA complex

Details for d1wsud1

PDB Entry: 1wsu (more details), 2.3 Å

PDB Description: C-terminal domain of elongation factor selB complexed with SECIS RNA
PDB Compounds: (D:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d1wsud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wsud1 a.4.5.35 (D:512-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
setqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindefy
whr

SCOPe Domain Coordinates for d1wsud1:

Click to download the PDB-style file with coordinates for d1wsud1.
(The format of our PDB-style files is described here.)

Timeline for d1wsud1: