Lineage for d1wpya2 (1wpy A:1-188)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869604Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 869605Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 869820Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)
  6. 869829Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 869830Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries)
    Uniprot O57883 1-188
  8. 869841Domain d1wpya2: 1wpy A:1-188 [121158]
    Other proteins in same PDB: d1wpya1, d1wpyb1
    automatically matched to 1WNL A:1-188
    complexed with btn

Details for d1wpya2

PDB Entry: 1wpy (more details), 1.6 Å

PDB Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3 in complex with biotin
PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOP Domain Sequences for d1wpya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpya2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOP Domain Coordinates for d1wpya2:

Click to download the PDB-style file with coordinates for d1wpya2.
(The format of our PDB-style files is described here.)

Timeline for d1wpya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpya1