![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins) |
![]() | Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries) Uniprot O57883 1-188 |
![]() | Domain d1wpya2: 1wpy A:1-188 [121158] Other proteins in same PDB: d1wpya1, d1wpyb1 automated match to d1wnla2 complexed with btn |
PDB Entry: 1wpy (more details), 1.6 Å
SCOPe Domain Sequences for d1wpya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpya2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d1wpya2: