PDB entry 1wpy

View 1wpy on RCSB PDB site
Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3 in complex with biotin
Class: ligase
Keywords: Biotin, Dimer, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2004-09-17, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • modified residue (0)
      • modified residue (43)
      • modified residue (142)
      • modified residue (175)
      • modified residue (185)
    Domains in SCOPe 2.07: d1wpya1, d1wpya2
  • Chain 'B':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • modified residue (0)
      • modified residue (43)
      • modified residue (142)
      • modified residue (175)
      • modified residue (185)
    Domains in SCOPe 2.07: d1wpyb1, d1wpyb2
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpyA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpyB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl