SCOPe 2.08: Domain d1wptb_: 1wpt B:

Lineage for d1wptb_ (1wpt B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)
   automatically mapped to Pfam PF09021

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)

6. Protein automated matches [190104] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [186826] (8 PDB entries)

8. Domain d1wptb_: 1wpt B: [121150]
   automated match to d1veab_

Details for d1wptb_

PDB Entry: 1wpt, 2.7 Å

PDB Description: crystal structure of hutp, an rna binding anti-termination protein

PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1wptb_:

Sequence; same for both SEQRES and ATOM records:

>d1wptb_ d.275.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi

Timeline for d1wptb_:

• d1wptb_ first appeared in SCOP 1.73, called d1wptb1
  
• d1wptb_ appears in SCOPe 2.07