Lineage for d1wmob3 (1wmo B:97-211)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640512Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1640513Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1640603Domain d1wmob3: 1wmo B:97-211 [121061]
    Other proteins in same PDB: d1wmoa1, d1wmob1
    automated match to d1ivwa3
    complexed with ni

Details for d1wmob3

PDB Entry: 1wmo (more details), 1.8 Å

PDB Description: Crystal structure of topaquinone-containing amine oxidase activated by nickel ion
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d1wmob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmob3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d1wmob3:

Click to download the PDB-style file with coordinates for d1wmob3.
(The format of our PDB-style files is described here.)

Timeline for d1wmob3: