SCOPe 2.07: Domain d1wmob1: 1wmo B:212-628

Lineage for d1wmob1 (1wmo B:212-628)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family)
   automatically mapped to Pfam PF01179

5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)

6. Protein Copper amine oxidase, domain 3 [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d1wmob1: 1wmo B:212-628 [121059]
   Other proteins in same PDB: d1wmoa2, d1wmoa3, d1wmob2, d1wmob3
   automated match to d1ivwa1
   complexed with ni

Details for d1wmob1

PDB Entry: 1wmo, 1.8 Å

PDB Description: Crystal structure of topaquinone-containing amine oxidase activated by nickel ion

PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d1wmob1:

Sequence; same for both SEQRES and ATOM records:

>d1wmob1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

Timeline for d1wmob1:

• d1wmob1 first appeared in SCOP 1.73
  
• d1wmob1 appears in SCOPe 2.06
  
• d1wmob1 appears in the current release, SCOPe 2.08