Lineage for d1wlra2 (1wlr A:177-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214036Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2214037Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2214038Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2214039Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2214040Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2214051Domain d1wlra2: 1wlr A:177-440 [121012]
    Other proteins in same PDB: d1wlra1
    automated match to d1n51a2
    complexed with cl, ipa, pg4

Details for d1wlra2

PDB Entry: 1wlr (more details), 2.1 Å

PDB Description: Apo aminopeptidase P from E. coli
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1wlra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlra2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d1wlra2:

Click to download the PDB-style file with coordinates for d1wlra2.
(The format of our PDB-style files is described here.)

Timeline for d1wlra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wlra1