| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) ![]() |
| Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) |
| Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
| Species Escherichia coli [TaxId:562] [53097] (20 PDB entries) |
| Domain d1wl9a1: 1wl9 A:1-176 [120998] Other proteins in same PDB: d1wl9a2 automated match to d1n51a1 complexed with cl, mn |
PDB Entry: 1wl9 (more details), 1.9 Å
SCOPe Domain Sequences for d1wl9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wl9a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d1wl9a1: