Lineage for d1wkhb_ (1wkh B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613841Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1613900Protein Acetylornithine/acetyl-lysine aminotransferase ArgD [142674] (1 species)
  7. 1613901Species Thermus thermophilus [TaxId:274] [142675] (3 PDB entries)
    Uniprot Q93R93 9-395
  8. 1613905Domain d1wkhb_: 1wkh B: [120982]
    automated match to d1vefa1
    complexed with ppe

Details for d1wkhb_

PDB Entry: 1wkh (more details), 2.25 Å

PDB Description: Acetylornithine aminotransferase from thermus thermophilus HB8
PDB Compounds: (B:) Acetylornithine/acetyl-lysine aminotransferase

SCOPe Domain Sequences for d1wkhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkhb_ c.67.1.4 (B:) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]}
wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
virflpplviekedlervveavravla

SCOPe Domain Coordinates for d1wkhb_:

Click to download the PDB-style file with coordinates for d1wkhb_.
(The format of our PDB-style files is described here.)

Timeline for d1wkhb_: