Lineage for d1wkhb1 (1wkh B:9-395)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840994Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 841063Protein Acetylornithine/acetyl-lysine aminotransferase ArgD [142674] (1 species)
  7. 841064Species Thermus thermophilus [TaxId:274] [142675] (3 PDB entries)
    Uniprot Q93R93 9-395
  8. 841068Domain d1wkhb1: 1wkh B:9-395 [120982]
    automatically matched to 1VEF A:9-395
    complexed with ppe

Details for d1wkhb1

PDB Entry: 1wkh (more details), 2.25 Å

PDB Description: Acetylornithine aminotransferase from thermus thermophilus HB8
PDB Compounds: (B:) Acetylornithine/acetyl-lysine aminotransferase

SCOP Domain Sequences for d1wkhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkhb1 c.67.1.4 (B:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]}
wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
virflpplviekedlervveavravla

SCOP Domain Coordinates for d1wkhb1:

Click to download the PDB-style file with coordinates for d1wkhb1.
(The format of our PDB-style files is described here.)

Timeline for d1wkhb1: