SCOP 1.75: Domain d1wkha1: 1wkh A:9-395

Lineage for d1wkha1 (1wkh A:9-395)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (9 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Acetylornithine/acetyl-lysine aminotransferase ArgD [142674] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142675] (3 PDB entries)
   Uniprot Q93R93 9-395

8. Domain d1wkha1: 1wkh A:9-395 [120981]
   automatically matched to 1VEF A:9-395
   complexed with ppe

Details for d1wkha1

PDB Entry: 1wkh, 2.25 Å

PDB Description: Acetylornithine aminotransferase from thermus thermophilus HB8

PDB Compounds: (A:) Acetylornithine/acetyl-lysine aminotransferase

SCOP Domain Sequences for d1wkha1:

Sequence; same for both SEQRES and ATOM records:

>d1wkha1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]}
wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
virflpplviekedlervveavravla

Timeline for d1wkha1:

• d1wkha1 first appeared in SCOP 1.73
  
• d1wkha1 appears in SCOPe 2.01
  
• d1wkha1 appears in the current release, SCOPe 2.08, called d1wkha_