Lineage for d1wfna1 (1wfn A:8-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2359377Protein Sidekick 2 [141051] (1 species)
  7. 2359378Species Human (Homo sapiens) [TaxId:9606] [141052] (4 PDB entries)
    Uniprot Q58EX2 1279-1395! Uniprot Q58EX2 578-685! Uniprot Q58EX2 881-988! Uniprot Q58EX2 981-1081
  8. 2359382Domain d1wfna1: 1wfn A:8-113 [120969]
    Other proteins in same PDB: d1wfna2, d1wfna3
    4th FnIII domain

Details for d1wfna1

PDB Entry: 1wfn (more details)

PDB Description: The fourth FN3 domain of human sidekick-2
PDB Compounds: (A:) sidekick 2

SCOPe Domain Sequences for d1wfna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}
pqlvrthedvpgpvghlsfseildtslkvswqepgekngiltgyrisweeynrtntrvth
ylpnvtleyrvtgltalttytievaamtskgqgqvsastissgvpp

SCOPe Domain Coordinates for d1wfna1:

Click to download the PDB-style file with coordinates for d1wfna1.
(The format of our PDB-style files is described here.)

Timeline for d1wfna1: