Lineage for d1we0a1 (1we0 A:1-166)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992926Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 992943Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species)
  7. 992944Species Amphibacillus xylanus [TaxId:1449] [142369] (1 PDB entry)
    Uniprot O87200 2-167
  8. 992945Domain d1we0a1: 1we0 A:1-166 [120930]
    Other proteins in same PDB: d1we0b_, d1we0c_, d1we0d_, d1we0e_, d1we0f_, d1we0g_, d1we0h_, d1we0i_, d1we0j_
    complexed with nh4

Details for d1we0a1

PDB Entry: 1we0 (more details), 2.9 Å

PDB Description: crystal structure of peroxiredoxin (ahpc) from amphibacillus xylanus
PDB Compounds: (A:) alkyl hydroperoxide reductase C

SCOPe Domain Sequences for d1we0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]}
sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc

SCOPe Domain Coordinates for d1we0a1:

Click to download the PDB-style file with coordinates for d1we0a1.
(The format of our PDB-style files is described here.)

Timeline for d1we0a1: