SCOP 1.73: Domain d1wdzb1: 1wdz B:2-228

Lineage for d1wdzb1 (1wdz B:2-228)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (3 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.3: IMD domain [140703] (1 protein)
   Pfam PF08397

6. Protein BAP2/IRSp53 N-terminal domain [140704] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140705] (2 PDB entries)

8. Domain d1wdzb1: 1wdz B:2-228 [120929]
   automatically matched to 1WDZ A:2-228

Details for d1wdzb1

PDB Entry: 1wdz, 2.63 Å

PDB Description: Crystal structure of RCB domain of IRSp53

PDB Compounds: (B:) insulin receptor substrate p53

SCOP Domain Sequences for d1wdzb1:

Sequence, based on SEQRES records:

>d1wdzb1 a.238.1.3 (B:2-228) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
kyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsd
gyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqq

Sequence, based on observed residues (ATOM records):

>d1wdzb1 a.238.1.3 (B:2-228) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
kyqteqrskgdaldkcqaelkklrkksqdkelqyidaisnkqgelenyvsdgyktaltee
rrrfcflvekqcavaknsaayhskgkellaqklplwqq

Timeline for d1wdzb1:

• d1wdzb1 is new in SCOP 1.73
  
• d1wdzb1 appears in SCOP 1.75
  
• d1wdzb1 appears in the current release, SCOPe 2.08, called d1wdzb2