Lineage for d1wdza1 (1wdz A:2-228)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651573Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 651574Superfamily a.238.1: BAR/IMD domain-like [103657] (3 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 651603Family a.238.1.3: IMD domain [140703] (1 protein)
    Pfam PF08397
  6. 651604Protein BAP2/IRSp53 N-terminal domain [140704] (1 species)
  7. 651605Species Human (Homo sapiens) [TaxId:9606] [140705] (2 PDB entries)
  8. 651608Domain d1wdza1: 1wdz A:2-228 [120928]

Details for d1wdza1

PDB Entry: 1wdz (more details), 2.63 Å

PDB Description: Crystal structure of RCB domain of IRSp53
PDB Compounds: (A:) insulin receptor substrate p53

SCOP Domain Sequences for d1wdza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdza1 a.238.1.3 (A:2-228) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
kyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsd
gyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqq

SCOP Domain Coordinates for d1wdza1:

Click to download the PDB-style file with coordinates for d1wdza1.
(The format of our PDB-style files is described here.)

Timeline for d1wdza1: