Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (1 PDB entry) TTHA1498 |
Domain d1wdta5: 1wdt A:378-454 [120915] Other proteins in same PDB: d1wdta1, d1wdta2, d1wdta3 complexed with gtp, mg |
PDB Entry: 1wdt (more details), 2.2 Å
SCOP Domain Sequences for d1wdta5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdta5 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} lpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelllwghgelhlatak erlqdygvevefsvpkv
Timeline for d1wdta5:
View in 3D Domains from same chain: (mouse over for more information) d1wdta1, d1wdta2, d1wdta3, d1wdta4 |