SCOPe 2.01: Domain d1wdta3: 1wdt A:455-569

Lineage for d1wdta3 (1wdt A:455-569)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Elongation factor G (EF-G), domain IV [54213] (2 species)

7. Species Thermus thermophilus, EF-G-2 [TaxId:274] [142925] (2 PDB entries)
   Uniprot Q5SI76 448-562
   TTHA1498

8. Domain d1wdta3: 1wdt A:455-569 [120913]
   Other proteins in same PDB: d1wdta1, d1wdta2, d1wdta4, d1wdta5
   complexed with gtp, mg

Details for d1wdta3

PDB Entry: 1wdt, 2.2 Å

PDB Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8

PDB Compounds: (A:) elongation factor G homolog

SCOPe Domain Sequences for d1wdta3:

Sequence; same for both SEQRES and ATOM records:

>d1wdta3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pyretikkvaegqgkykkqtgghgqygdvwlrlepaseygfewritggvipskyqeaiee
gikeaakkgvlagfpvmgfkaivyngsyhevdssdlafqiaaslafkkvmaeahp

Timeline for d1wdta3:

• d1wdta3 first appeared in SCOP 1.73
  
• d1wdta3 appears in SCOP 1.75
  
• d1wdta3 appears in SCOPe 2.02
  
• d1wdta3 appears in the current release, SCOPe 2.08