Lineage for d1wb0a2 (1wb0 A:267-336)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720724Protein Chitotriosidase [82628] (1 species)
  7. 720725Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries)
  8. 720726Domain d1wb0a2: 1wb0 A:267-336 [120826]
    Other proteins in same PDB: d1wb0a1
    automatically matched to d1hkia2
    complexed with gol, ipa, rag, so4

Details for d1wb0a2

PDB Entry: 1wb0 (more details), 1.65 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
PDB Compounds: (A:) chitotriosidase 1

SCOP Domain Sequences for d1wb0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

SCOP Domain Coordinates for d1wb0a2:

Click to download the PDB-style file with coordinates for d1wb0a2.
(The format of our PDB-style files is described here.)

Timeline for d1wb0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wb0a1