PDB entry 1wb0

View 1wb0 on RCSB PDB site
Description: specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase
Class: hydrolase
Keywords: human chitinase, argadin, cyclopentapeptide inhibitors, chitinase inhibitors, alternative splicing, carbohydrate metabolism, chitin degradation, chitin-binding, glycosidase, hydrolase
Deposited on 2004-10-29, released 2005-01-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitotriosidase 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wb0a1, d1wb0a2
  • Heterogens: SO4, RAG, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb0A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqelslpylpsgtpelevpkpgqpsepehgpspgqdtfcqgkadglypnprerssfysca
    agrlfqqscptglvfsnsckcctwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb0A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqels