Lineage for d1wao42 (1wao 4:176-494)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1680021Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 1680022Species Human (Homo sapiens) [TaxId:9606] [111232] (10 PDB entries)
    Uniprot P53041 176-499
  8. 1680044Domain d1wao42: 1wao 4:176-494 [120820]
    Other proteins in same PDB: d1wao11, d1wao21, d1wao31, d1wao41
    automatically matched to d1s95b_
    complexed with mn

Details for d1wao42

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (4:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao42:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wao42 d.159.1.3 (4:176-494) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmayantll

SCOPe Domain Coordinates for d1wao42:

Click to download the PDB-style file with coordinates for d1wao42.
(The format of our PDB-style files is described here.)

Timeline for d1wao42: