Lineage for d1wao32 (1wao 3:176-499)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440615Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 1440616Species Human (Homo sapiens) [TaxId:9606] [111232] (10 PDB entries)
    Uniprot P53041 176-499
  8. 1440637Domain d1wao32: 1wao 3:176-499 [120818]
    Other proteins in same PDB: d1wao11, d1wao21, d1wao31, d1wao41
    automatically matched to d1s95b_
    complexed with mn

Details for d1wao32

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (3:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao32:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wao32 d.159.1.3 (3:176-499) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmayantllqlgmm

SCOPe Domain Coordinates for d1wao32:

Click to download the PDB-style file with coordinates for d1wao32.
(The format of our PDB-style files is described here.)

Timeline for d1wao32: