Lineage for d1wao21 (1wao 2:23-175)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279354Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1279355Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1279420Protein Protein phosphatase 5 [48454] (1 species)
  7. 1279421Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)
  8. 1279424Domain d1wao21: 1wao 2:23-175 [120815]
    Other proteins in same PDB: d1wao12, d1wao22, d1wao32, d1wao42
    automatically matched to d1a17__
    complexed with mn

Details for d1wao21

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (2:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao21:

Sequence, based on SEQRES records: (download)

>d1wao21 a.118.8.1 (2:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferaiagdehkrsvvdsldiesmtiede

Sequence, based on observed residues (ATOM records): (download)

>d1wao21 a.118.8.1 (2:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferakrsvvdsldiesmtiede

SCOPe Domain Coordinates for d1wao21:

Click to download the PDB-style file with coordinates for d1wao21.
(The format of our PDB-style files is described here.)

Timeline for d1wao21: