Lineage for d1wa6x_ (1wa6 X:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070787Family b.82.2.1: Penicillin synthase-like [51198] (5 protein domains)
    common fold is rather distorted
  6. 2070845Protein automated matches [190217] (4 species)
    not a true protein
  7. 2070861Species Petunia hybrida [TaxId:4102] [188068] (1 PDB entry)
  8. 2070862Domain d1wa6x_: 1wa6 X: [120808]
    automated match to d1w9ya1
    complexed with fe2, po4, so4

Details for d1wa6x_

PDB Entry: 1wa6 (more details), 2.55 Å

PDB Description: the structure of acc oxidase
PDB Compounds: (X:) 1-aminocyclopropane-1-carboxylate oxidase 1

SCOPe Domain Sequences for d1wa6x_:

Sequence, based on SEQRES records: (download)

>d1wa6x_ b.82.2.1 (X:) automated matches {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakeprf
eamkam

Sequence, based on observed residues (ATOM records): (download)

>d1wa6x_ b.82.2.1 (X:) automated matches {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkam

SCOPe Domain Coordinates for d1wa6x_:

Click to download the PDB-style file with coordinates for d1wa6x_.
(The format of our PDB-style files is described here.)

Timeline for d1wa6x_: