Lineage for d1wa6x1 (1wa6 X:2-307)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677673Family b.82.2.1: Penicillin synthase-like [51198] (4 proteins)
    common fold is rather distorted
  6. 677674Protein 1-aminocyclopropane-1-carboxylate oxidase 1 [141621] (1 species)
  7. 677675Species Petunia hybrida [TaxId:4102] [141622] (2 PDB entries)
  8. 677677Domain d1wa6x1: 1wa6 X:2-307 [120808]
    automatically matched to 1W9Y A:2-308
    complexed with fe2, po4, so4

Details for d1wa6x1

PDB Entry: 1wa6 (more details), 2.55 Å

PDB Description: the structure of acc oxidase
PDB Compounds: (X:) 1-aminocyclopropane-1-carboxylate oxidase 1

SCOP Domain Sequences for d1wa6x1:

Sequence, based on SEQRES records: (download)

>d1wa6x1 b.82.2.1 (X:2-307) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakeprf
eamkam

Sequence, based on observed residues (ATOM records): (download)

>d1wa6x1 b.82.2.1 (X:2-307) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkam

SCOP Domain Coordinates for d1wa6x1:

Click to download the PDB-style file with coordinates for d1wa6x1.
(The format of our PDB-style files is described here.)

Timeline for d1wa6x1: