Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (24 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries) |
Domain d1wa3b_: 1wa3 B: [120803] automated match to d1vlwb_ complexed with pyr, so4 |
PDB Entry: 1wa3 (more details), 1.9 Å
SCOPe Domain Sequences for d1wa3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa3b_ c.1.10.1 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} kmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkek gaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkam klghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsal vkgtpdevrekakafvekirgc
Timeline for d1wa3b_: